PDB entry 6bak

View 6bak on RCSB PDB site
Description: The structure of the Stigmatella aurantiaca phytochrome chromophore binding domain T289H mutant
Class: signaling protein
Keywords: signaling protein
Deposited on 2017-10-13, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoreceptor-histidine kinase BphP
    Species: Stigmatella aurantiaca DW4/3-1 [TaxId:378806]
    Gene: STAUR_8015, STIAU_3396
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q097N3 (0-302)
      • engineered mutation (273)
    Domains in SCOPe 2.07: d6baka1, d6baka2
  • Heterogens: BLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6bakA (A:)
    tncdrepihipgaiqphgvllvlsepglvlthasenapavlgnsaeqllgaplghfieps
    vrepleadlrsarlkqlnplkvvwrvdgvdrffdgiahrhqgrlilelepsshreavpfl
    sffhavrdglsrlrdardlqelceavvqevrgltgfdraiiyrfdaewngsviaeardar
    adpylglhfpasdiprqarelyqlnwlriiptidyqparvralpghgepldlsfsvlrsv
    spihleylhnmgvqasmsislmkdgklwglischqvsgtryvpyevrtaceflgevmssl
    laa