PDB entry 6ba5

View 6ba5 on RCSB PDB site
Description: Potent and Selective Antitumor Activity of a T-Cell Engaging Bispecific Antibody Targeting a Membrane-Proximal Epitope of ROR1
Class: immune system
Keywords: Single chain Fv, ScFv, Antibody, ROR1, Kringle domain, receptor tyrosine kinase-like orphan receptor, Phage display, IMMUNE SYSTEM
Deposited on 2017-10-12, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable domain of Light Chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5 (Start-113)
    Domains in SCOPe 2.07: d6ba5a_
  • Chain 'B':
    Compound: Variable domain Heavy chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5
    Domains in SCOPe 2.07: d6ba5b_
  • Chain 'C':
    Compound: Variable domain of Light Chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5 (Start-113)
    Domains in SCOPe 2.07: d6ba5c_
  • Chain 'D':
    Compound: Variable domain Heavy chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5
    Domains in SCOPe 2.07: d6ba5d_
  • Chain 'E':
    Compound: Variable domain of Light Chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5 (Start-113)
    Domains in SCOPe 2.07: d6ba5e_
  • Chain 'F':
    Compound: Variable domain Heavy chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5
    Domains in SCOPe 2.07: d6ba5f_
  • Chain 'G':
    Compound: Variable domain of Light Chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5 (Start-113)
    Domains in SCOPe 2.07: d6ba5g_
  • Chain 'H':
    Compound: Variable domain Heavy chain, antibody R11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6BA5
    Domains in SCOPe 2.07: d6ba5h_
  • Chain 'M':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba5m_
  • Chain 'N':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba5n_
  • Chain 'O':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba5o_
  • Chain 'P':
    Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROR1, NTRKR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba5p_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ba5A (A:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5A (A:)
    elvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvps
    rfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ba5B (B:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5B (B:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ba5C (C:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5C (C:)
    elvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvps
    rfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ba5D (D:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5D (D:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ba5E (E:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5E (E:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ba5F (F:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5F (F:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ba5G (G:)
    gshmelvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlas
    gvpsrfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5G (G:)
    melvmtqtpsstsgavggtvtincqasqsidsnlawfqqkpgqpptlliyrasnlasgvp
    srfsgsrsgteytltisgvqredaatyyclggvgnvsyrtsfgggtevvvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ba5H (H:)
    sqsvkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwya
    swvkgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5H (H:)
    vkesegdlvtpagnltltctasgsdindypiswvrqapgkglewigfinsggstwyaswv
    kgrftisrtsttvdlkmtslttddtatyfcargystyygdfniwgpgtlvtis
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ba5M (M:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5M (M:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ba5N (N:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5N (N:)
    hkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqke
    apwcftldenfksdlcdipac
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ba5O (O:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5O (O:)
    kcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqkea
    pwcftldenfksdlcdipac
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6ba5P (P:)
    mhkcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
    eapwcftldenfksdlcdipac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba5P (P:)
    kcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqkea
    pwcftldenfksdlcdipac