PDB entry 6ba1

View 6ba1 on RCSB PDB site
Description: Purine-Preferring Ribonucleoside Hydrolase from Gardnerella vaginalis
Class: hydrolase
Keywords: Nucleoside Hydrolase Nitrogen Metabolism, HYDROLASE
Deposited on 2017-10-11, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1a_
  • Chain 'B':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1b_
  • Chain 'C':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1c_
  • Chain 'D':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1d_
  • Chain 'E':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1e_
  • Chain 'F':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1f_
  • Chain 'G':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1g_
  • Chain 'H':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1h_
  • Chain 'I':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1i_
  • Chain 'J':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1j_
  • Chain 'K':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1k_
  • Chain 'L':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1l_
  • Chain 'M':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1m_
  • Chain 'N':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1n_
  • Chain 'O':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1o_
  • Chain 'P':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1p_
  • Chain 'Q':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1q_
  • Chain 'R':
    Compound: Inosine-uridine preferring nucleoside hydrolase
    Species: Gardnerella vaginalis 315-A [TaxId:879307]
    Gene: HMPREF9435_1145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ba1r_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ba1A (A:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1A (A:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ba1B (B:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1B (B:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ba1C (C:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1C (C:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ba1D (D:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1D (D:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ba1E (E:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1E (E:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ba1F (F:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1F (F:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ba1G (G:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1G (G:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ba1H (H:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1H (H:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ba1I (I:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1I (I:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ba1J (J:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1J (J:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ba1K (K:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1K (K:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ba1L (L:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1L (L:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ba1M (M:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1M (M:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ba1N (N:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1N (N:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ba1O (O:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1O (O:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6ba1P (P:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1P (P:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6ba1Q (Q:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1Q (Q:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6ba1R (R:)
    gshmkklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllgh
    pevkvykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkk
    ygkdlvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpda
    adilfrsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaph
    lggcglhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgv
    dvprflnefmtrisglakiag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ba1R (R:)
    kklildldtgvddtlaisyalgspemeligitgtygnvlmeqgvrnalaitdllghpevk
    vykglshastkdsfevlpisafihgdngigdveipdsprkaedesavdfiidsvkkygkd
    lvyvptgpmtniaaalkkapeikdeigkivlmggaltihgnvnawteanisqdpdaadil
    frsgapvtmigldvtlqtlltyketkqwrdlntkagkfladmtdfyikayettaphlggc
    glhdplavavavdptlvttlpinmqvdvegptrgrtigdvtrlndpvktmqvavgvdvpr
    flnefmtrisglakia