PDB entry 6b8y

View 6b8y on RCSB PDB site
Description: TGF-BETA RECEPTOR TYPE 1 KINASE DOMAIN (T204D) IN COMPLEX WITH N-(3-fluoropyridin-4-yl)-2-[6-(trifluoromethyl)pyridin-2-yl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: alk5, kinase domain, transferase-transferase inhibitor complex, transferase
Deposited on 2017-10-09, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (3-End)
      • expression tag (1-2)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d6b8ya1, d6b8ya2
  • Heterogens: D0A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b8yA (A:)
    ghmtiardivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrh
    enilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahl
    hmeivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtk
    rymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdp
    sveemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls
    qqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b8yA (A:)
    hmtiardivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qegik