PDB entry 6b8d

View 6b8d on RCSB PDB site
Description: 1.78 Angstrom Resolution Crystal Structure of N-terminal Fragment (residues 1-405) of Elongation Factor G from Haemophilus influenzae
Class: ribosomal protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Elongation factor G, RIBOSOMAL PROTEIN
Deposited on 2017-10-06, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: fusA, fus, HI_0579
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b8da1, d6b8da2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b8dA (A:)
    snamarttpieryrnigisahidagktttterilfytgvshkigevhdgaatmdwmeqeq
    ergititsaattafwsgmsqqfpqhrinvidtpghvdftveversmrvldgavmvycavg
    gvqpqsetvwrqankyevpriafvnkmdrtganflrvveqlktrlganaiplqlpvgaee
    nftgvvdlikmkainwneadqgmtftyeevpanmqadceewrqnlveaaaeaseelmeky
    lggedlteeeiksalrqrvlaneiilvtcgsafknkgvqamldavveylpaptdipaikg
    inpdetegerhasdeepfsslafkiatdpfvgnltffrvysgvinsgdtvlnsvrqkrer
    fgrivqmhankreeikevragdiaaaiglkdvttgdtlcaidapiile
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b8dA (A:)
    marttpieryrnigisahidagktttterilfytgvshkigetsaattafwsgmsqqfpq
    hrinvidtptveversmrvldgavmvycavggvqpqsetvwrqankyevpriafvnkmdr
    tganflrvveqlktrlganaiplqlpvgaeenftgvvdlikmkainwneadqgmtftyee
    vpanmqadceewrqnlveaaaeaseelmekylggedlteeeiksalrqrvlaneiilvtc
    gsafknkgvqamldavveylpaptdipaikginpdetegerhasdeepfsslafkiatdp
    fvgnltffrvysgvinsgdtvlnsvrqkrerfgrivqmhankreeikevragdiaaaigl
    kdvttgdtlcaidapiile