PDB entry 6b89

View 6b89 on RCSB PDB site
Description: E. coli LptB in complex with ADP and novobiocin
Class: lipid transport/activator
Keywords: LptB, ABC transporter, LPS transport, LIPID TRANSPORT, activator, lipid transport-activator complex
Deposited on 2017-10-05, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharide export system ATP-binding protein LptB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lptB, yhbG, b3201, JW3168
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b89a_
  • Chain 'B':
    Compound: Lipopolysaccharide export system ATP-binding protein LptB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lptB, yhbG, b3201, JW3168
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b89b_
  • Heterogens: ADP, MG, NOV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b89A (A:)
    atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
    iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
    meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
    hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylgedfrl
    ehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b89A (A:)
    atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
    iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
    meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
    hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b89B (B:)
    atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
    iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
    meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
    hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylgedfrl
    ehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b89B (B:)
    atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
    iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
    meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
    hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqd