PDB entry 6b84

View 6b84 on RCSB PDB site
Description: Crystal structure of Myotoxin II from Bothrops moojeni
Class: toxin
Keywords: Myotoxin II, Bothrops moojeni, Phospholipase A2-like, TOXIN
Deposited on 2017-10-05, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b84a_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b84b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b84A (A:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b84B (B:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
    pc