PDB entry 6b80

View 6b80 on RCSB PDB site
Description: Crystal structure of myotoxin II from Bothrops moojeni complexed to myristic acid
Class: toxin
Keywords: Myotoxin II, Phospholipase A2-like, Bothrops moojeni, TOXIN
Deposited on 2017-10-05, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b80a_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog 2
    Species: Bothrops moojeni [TaxId:98334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b80b_
  • Heterogens: MYR, SO4, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b80A (A:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b80B (B:)
    slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
    pc