PDB entry 6b71

View 6b71 on RCSB PDB site
Description: Crystal Structure of Purine Nucleoside Phosphorylase Isoform 2 from Schistosoma mansoni in complex with3-(4-chlorophenyl)-5H,6H-imidazo[2,1-b][1,3]thiazole
Class: transferase/inhibitor
Keywords: Purine Nucleoside Phosphorylase, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2017-10-03, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b71a_
  • Heterogens: A5H, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b71A (A:)
    mttpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpk
    ttvaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlag
    ginrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkia
    qendfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlav
    sliannsildaendvsinhekvlavaekradllqmwfkeiitrlpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b71A (A:)
    vvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttva
    ghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginr
    klksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqend
    fqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavslia
    nnsildaendvsinhekvlavaekradllqmwfkeiitrlp