PDB entry 6b6i

View 6b6i on RCSB PDB site
Description: 2.4A resolution structure of human Norovirus GII.4 protease
Class: VIRAL PROTEIN,Protease
Keywords: 3C-like protease, viral protease, GII.4, Minerva, VIRAL PROTEIN, Protease
Deposited on 2017-10-02, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ia_
  • Chain 'B':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (Start-180)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ib_
  • Chain 'C':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ic_
  • Chain 'D':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (Start-180)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6id_
  • Chain 'E':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ie_
  • Chain 'F':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (Start-180)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6if_
  • Chain 'G':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (0-End)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ig_
  • Chain 'H':
    Compound: 3C-like protease
    Species: Norovirus GII.4 [TaxId:489821]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A076EGG6 (0-180)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d6b6ih_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b6iA (A:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iA (A:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b6iB (B:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iB (B:)
    psiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrfpk
    pirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgmll
    tgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b6iC (C:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iC (C:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b6iD (D:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iD (D:)
    siwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrfpkp
    irtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgmllt
    gsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6b6iE (E:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iE (E:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6b6iF (F:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iF (F:)
    siwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrfpkp
    irtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgmllt
    gsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatle
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6b6iG (G:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b6iG (G:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b6iH (H:)
    appsiwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrf
    pkpirtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgm
    lltgsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatl
    e