PDB entry 6b65

View 6b65 on RCSB PDB site
Description: IMPase (AF2372) R92Q/K164E
Class: hydrolase
Keywords: Osmolyte binding protein, inositol monophosphatase, HYDROLASE
Deposited on 2017-10-01, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30298 (0-251)
      • engineered mutation (91)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d6b65a_
  • Chain 'B':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30298 (0-251)
      • engineered mutation (91)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d6b65b_
  • Heterogens: SO4, MG, PEG, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b65A (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatqgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfermrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b65B (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatqgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfermrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik