PDB entry 6b60

View 6b60 on RCSB PDB site
Description: IMPase (AF2372) with 25 mM Glutamate
Class: hydrolase
Keywords: Osmolyte binding protein Inositol mono phosphatase, HYDROLASE
Deposited on 2017-10-01, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b60a_
  • Chain 'B':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b60b_
  • Heterogens: GLU, SO4, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b60A (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b60B (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik