PDB entry 6b5z

View 6b5z on RCSB PDB site
Description: IMPase (AF2372) with 25 mM Asp
Class: hydrolase
Keywords: Osmolyte binding protein, hyperthermophilic archaea, HYDROLASE
Deposited on 2017-10-01, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5za_
  • Chain 'B':
    Compound: Fructose-1,6-bisphosphatase/inositol-1-monophosphatase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: suhB, AF_2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5zb_
  • Heterogens: ASP, SO4, MG, INS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b5zA (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b5zB (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik