PDB entry 6b5d

View 6b5d on RCSB PDB site
Description: Structural Basis for Katanin Self-Assembly
Class: cell cycle
Keywords: Katanin, AAA ATPase, Microtubule severing protein, Meiotic spindle formation protein mei-1, CELL CYCLE
Deposited on 2017-09-29, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Meiotic spindle formation protein mei-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: mei-1, T01G9.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b5da_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b5dA (A:)
    sfdasaydayivqavrgtmatntentmslddiigmhdvkqvlheavtlpllvpeffqglr
    spwkamvlagppgtgktliaraiasessstfftvsstdlsskwrgdsekivrllfelarf
    yapsiifideidtlggqrgnsgeheasrrvkseflvqmdgsqnkfdsrrvfvlaatnipw
    eldealrrrfekrifiplpdidarkklieksmegtpksdeinyddlaartegfsgadvvs
    lcrtaainvlrrydtkslrggeltaameslkaelvrnidfeaalqavspsagpdtmlkck
    ewcdsfgam
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5dA (A:)
    sfdasaydayivqavrgtmatntentmslddiigmhdvkqvlheavtlpllvpeffqglr
    spwkamvlagppgtgktliaraiasessstfftvsstdlssksekivrllfelarfyaps
    iifideidtlgeasrrvkseflvqmdgsqrvfvlaatnipweldealrrrfekrifiplp
    didarkklieksmegtpksdeinyddlaartegfsgadvvslcrtaainvlrrydtkslr
    ggeltaameslkaelvrnidfeaalqavspsagpdtmlkckewcds