PDB entry 6b5c

View 6b5c on RCSB PDB site
Description: Structural Basis for Katanin Self-Assembly
Class: cell cycle
Keywords: Katanin, AAA ATPase, Microtubule severing protein, CELL CYCLE
Deposited on 2017-09-29, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Katanin p60 ATPase-containing subunit A-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KATNAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BW62 (0-306)
      • engineered mutation (124)
    Domains in SCOPe 2.07: d6b5ca_
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b5cA (A:)
    agydkdlvealerdivsrnpsihwddiadleeakkllreavvlpmwmpdffkgirrpwkg
    vlmvgppgtgktmlakavatecgttffnvssstltskyrgeseklvrllfemarfyaptt
    ifidqidsicsrrgtsdeheasrrvkselliqmdgvggalenddpskmvmvlaatnfpwd
    idealrrrlekriyiplptakgraellkinlreveldpdiqlediaekiegysgaditnv
    crdaslmamrrringlspeeiralskeelqmpvtkgdfelalkkiaksvsaadlekyekw
    mvefgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b5cA (A:)
    agydkdlvealerdivsrnpsihwddiadleeakkllreavvlpmwmpdffkgirrpwkg
    vlmvgppgtgktmlakavatecgttffnvssstltskseklvrllfemarfyapttifid
    qidsicsrtsdeheasrrvkselliqmdgvpskmvmvlaatnfpwdidealrrrlekriy
    iplptakgraellkinlreveldpdiqlediaekiegysgaditnvcrdaslmamrrrin
    glspeeiralskeelqmpvtkgdfelalkkiaksvsaadlekyekwmvefgsa