PDB entry 6b4r

View 6b4r on RCSB PDB site
Description: The crystal structure of the aldehyde dehydrogenase KauB from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, KauB, OXIDOREDUCTASE
Deposited on 2017-09-27, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KauB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA5312
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b4ra_
  • Chain 'B':
    Compound: KauB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA5312
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b4rb_
  • Chain 'C':
    Compound: KauB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA5312
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b4rc_
  • Chain 'D':
    Compound: KauB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA5312
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b4rd_
  • Heterogens: EDO, K, TOE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b4rA (A:)
    mttltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladae
    qavkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhid
    vasaanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgp
    alatgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtl
    vftgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqge
    vctagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieag
    hndgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavr
    iandtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkatwikl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b4rB (B:)
    mttltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladae
    qavkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhid
    vasaanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgp
    alatgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtl
    vftgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqge
    vctagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieag
    hndgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavr
    iandtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkatwikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b4rB (B:)
    tltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladaeqa
    vkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhidva
    saanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgpal
    atgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtlvf
    tgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqgevc
    tagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieaghn
    dgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavria
    ndtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdkslh
    afdkytelkatwikl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b4rC (C:)
    mttltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladae
    qavkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhid
    vasaanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgp
    alatgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtl
    vftgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqge
    vctagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieag
    hndgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavr
    iandtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkatwikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b4rC (C:)
    tltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladaeqa
    vkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhidva
    saanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgpal
    atgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtlvf
    tgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqgevc
    tagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieaghn
    dgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavria
    ndtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdkslh
    afdkytelkatwikl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b4rD (D:)
    mttltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladae
    qavkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhid
    vasaanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgp
    alatgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtl
    vftgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqge
    vctagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieag
    hndgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavr
    iandtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkatwikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b4rD (D:)
    tltradwearakdlkiegrafvngeysnaasgetfdclspvdgrflakvascdladaeqa
    vkvarnafdsgawsrlapakrkqtmirfadlllenaeelalletldmgkpisdslhidva
    saanslrwsaeaidkiydevaatphaelglvtrepvgvvaaivpwnfpllmscwklgpal
    atgnsvilkpsekspltairiaqlaveagipkgvfnvlpgyghtvgkalalhmdvdtlvf
    tgstkiakqlmvyagesnmkrvwleaggkspnivfadapdlkaaaeaaagaiafnqgevc
    tagsrllversikdkflplviealkgwkpgnpldpetnvgalvdtqqmntvlsyieaghn
    dgaklvaggkrtleetggtyveptifdgvtnamkiareeifgpvlsviefedaeeavria
    ndtpyglaaavwtsnlskahltakalragsvwvnqydggdmtapfggfkqsgngrdkslh
    afdkytelkatwikl