PDB entry 6b41

View 6b41 on RCSB PDB site
Description: Menin bound to M-525
Class: protein binding/inhibitor
Keywords: Covalent Inhibitor, MEN1 syndrome, leukemia, PROTEIN BINDING-INHIBITOR complex
Deposited on 2017-09-25, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b41a1, d6b41a2
  • Heterogens: CJV, 7PR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b41A (A:)
    sglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpe
    ltfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkk
    vsdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsed
    hawvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmv
    cainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdplt
    lyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeei
    ykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecfahllrfydgi
    ckweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpeggstaqvpap
    taspppegpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkkqkvstpsdytl
    sflkrqrkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b41A (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
    tfqpspapdgltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdv
    iwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawv
    vfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcain
    psidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhk
    giasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykef
    fevandvipnllkeaaslleasalqdpecfahllrfydgickweegsptpvlhvgwatfl
    vqslgrfegqvrqkvrivsgtvagtargpvltfqsekmkgmkellvatkinssaiklqlt
    a