PDB entry 6b3i

View 6b3i on RCSB PDB site
Description: Annexin A13a
Class: lipid binding protein
Keywords: annexin, LIPID BINDING PROTEIN
Deposited on 2017-09-21, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Annexin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ia_
  • Chain 'B':
    Compound: Annexin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ib_
  • Chain 'C':
    Compound: Annexin
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ic_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b3iA (A:)
    msyyhhhhhhdydipttenlyfqgamemgnrhakasspqgfdvdrdakklnkackgmgtn
    eaaiieilsgrtsderqqikqkykatygkeleevlkselsgnfektalalldhpseyaar
    qlqkamkglgtdesvlievlctrtnkeiiaikeayqrlfdrslesdvkgdtsgnlkkilv
    sllqanrnegddvdkdlagqdakdlydagegrwgtdelafnevlakrsykqlratfqayq
    iligkdieeaieeetsgdlqkayltlvrcaqdcedyfaerlyksmkgagtdeetliriiv
    traevdlqgikakfqekyqkslsdmvrsdtsgdfrkllvallh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3iA (A:)
    gfdvdrdakklnkackgmgtneaaiieilsgrtsderqqikqkykatygkeleevlksel
    sgnfektalalldhpseyaarqlqkamkglgtdesvlievlctrtnkeiiaikeayqrlf
    drslesdvkgdtsgnlkkilvsllqanrnegddvdkdlagqdakdlydagegrwgtdela
    fnevlakrsykqlratfqayqiligkdieeaieeetsgdlqkayltlvrcaqdcedyfae
    rlyksmkgagtdeetliriivtraevdlqgikakfqekyqkslsdmvrsdtsgdfrkllv
    allh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b3iB (B:)
    msyyhhhhhhdydipttenlyfqgamemgnrhakasspqgfdvdrdakklnkackgmgtn
    eaaiieilsgrtsderqqikqkykatygkeleevlkselsgnfektalalldhpseyaar
    qlqkamkglgtdesvlievlctrtnkeiiaikeayqrlfdrslesdvkgdtsgnlkkilv
    sllqanrnegddvdkdlagqdakdlydagegrwgtdelafnevlakrsykqlratfqayq
    iligkdieeaieeetsgdlqkayltlvrcaqdcedyfaerlyksmkgagtdeetliriiv
    traevdlqgikakfqekyqkslsdmvrsdtsgdfrkllvallh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3iB (B:)
    qgfdvdrdakklnkackgmgtneaaiieilsgrtsderqqikqkykatygkeleevlkse
    lsgnfektalalldhpseyaarqlqkamkglgtdesvlievlctrtnkeiiaikeayqrl
    fdrslesdvkgdtsgnlkkilvsllqanrnegddvdkdlagqdakdlydagegrwdelaf
    nevlakrsykqlratfqayqiligkdieeaieeetsgdlqkayltlvrcaqdcedyfaer
    lyksmkgagtdeetliriivtraevdlqgikakfqekyqkslsdmvrsdtsgdfrkllva
    llh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b3iC (C:)
    msyyhhhhhhdydipttenlyfqgamemgnrhakasspqgfdvdrdakklnkackgmgtn
    eaaiieilsgrtsderqqikqkykatygkeleevlkselsgnfektalalldhpseyaar
    qlqkamkglgtdesvlievlctrtnkeiiaikeayqrlfdrslesdvkgdtsgnlkkilv
    sllqanrnegddvdkdlagqdakdlydagegrwgtdelafnevlakrsykqlratfqayq
    iligkdieeaieeetsgdlqkayltlvrcaqdcedyfaerlyksmkgagtdeetliriiv
    traevdlqgikakfqekyqkslsdmvrsdtsgdfrkllvallh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3iC (C:)
    gfdvdrdakklnkackgmgtneaaiieilsgrtsderqqikqkykatygkeleevlksel
    sgnfektalalldhpseyaarqlqkamkglgtdesvlievlctrtnkeiiaikeayqrlf
    drslesdvkgdtsgnlkkilvsllqanrnegddvdkdlagqdakdlydagegrwgtdela
    fnevlakrsykqlratfqayqiligkdieeaieeetsgdlqkayltlvrcaqdcedyfae
    rlyksmkgagtdeetliriivtraevdlqgikakfqekyqkslsdmvrsdtsgdfrkllv
    allh