PDB entry 6b3e

View 6b3e on RCSB PDB site
Description: Crystal structure of human CDK12/CyclinK in complex with an inhibitor
Class: transferase/inhibitor
Keywords: Inhibitor, complex, kinase, TRANSFERASE, TRANSFERASE-INHIBITOR complex
Deposited on 2017-09-21, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ea_
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3eb1, d6b3eb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK12, CRK7, CRKRS, KIAA0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ec_
  • Chain 'D':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b3ed1, d6b3ed2
  • Heterogens: MG, CJM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b3eA (A:)
    sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
    ilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhi
    ksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkv
    itlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspc
    pavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlq
    sdflkdvelskmappdlphw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3eA (A:)
    sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
    ilrqlihrsvvnmkeivtdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlmeg
    leychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrppel
    llgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdvikl
    pyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvels
    kmappdlphw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b3eB (B:)
    mkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdv
    gtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikta
    rsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqk
    lvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvq
    dvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3eB (B:)
    tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
    rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
    vmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlsl
    qwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6b3eC (C:)
    sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
    ilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhi
    ksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkv
    itlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspc
    pavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlq
    sdflkdvelskmappdlphw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3eC (C:)
    wgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikil
    rqlihrsvvnmkeivtdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlmegle
    ychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrppelll
    geerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdviklpy
    fntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvelskm
    appdlphw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6b3eD (D:)
    mkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdv
    gtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikta
    rsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqk
    lvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvq
    dvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b3eD (D:)
    kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
    fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
    mvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslq
    wepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq
    g