PDB entry 6b30

View 6b30 on RCSB PDB site
Description: Structure of RORgt in complex with a novel inverse agonist 1
Class: signaling protein
Keywords: Complex, inverse agonist, Nuclear Hormone Receptor, SIGNALING PROTEIN
Deposited on 2017-09-20, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b30a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b30b_
  • Heterogens: CFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b30A (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b30B (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b30B (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslc