PDB entry 6b2b

View 6b2b on RCSB PDB site
Description: Crystal structure of fluoride channel Fluc Ec2 F83M Mutant
Class: transport protein
Keywords: alpha helix, ion channel, membrane protein, TRANSPORT PROTEIN
Deposited on 2017-09-19, released 2017-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoride ion transporter CrcB
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4 (Start-125)
      • engineered mutation (24)
      • engineered mutation (82)
  • Chain 'B':
    Compound: Fluoride ion transporter CrcB
    Species: Escherichia coli [TaxId:562]
    Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6J5N4 (0-End)
      • engineered mutation (24)
      • engineered mutation (82)
  • Chain 'C':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B2B (0-95)
    Domains in SCOPe 2.08: d6b2bc_
  • Chain 'D':
    Compound: monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6B2B (0-95)
    Domains in SCOPe 2.08: d6b2bd_
  • Heterogens: DMU, F, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b2bC (C:)
    svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
    sglkpgvdytitvytmyysysdlysysspisinyrt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6b2bD (D:)
    svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
    sglkpgvdytitvytmyysysdlysysspisinyrt