PDB entry 6b2b
View 6b2b on RCSB PDB site
Description: Crystal structure of fluoride channel Fluc Ec2 F83M Mutant
Class: transport protein
Keywords: alpha helix, ion channel, membrane protein, TRANSPORT PROTEIN
Deposited on
2017-09-19, released
2017-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-11-20, with a file datestamp of
2019-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fluoride ion transporter CrcB
Species: Escherichia coli [TaxId:562]
Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
Database cross-references and differences (RAF-indexed):
- Uniprot Q6J5N4 (Start-125)
- engineered mutation (24)
- engineered mutation (82)
- Chain 'B':
Compound: Fluoride ion transporter CrcB
Species: Escherichia coli [TaxId:562]
Gene: crcB, A4T40_27000, AC789_145pl00540, AKG99_27195, BET08_05210, BK292_28205, BK334_22235, BK373_23795, BUE82_27975, ECONIH1_26550, ECS286_0026, MJ49_27125, pCTXM15_EC8_00123, pO103_22
Database cross-references and differences (RAF-indexed):
- Uniprot Q6J5N4 (0-End)
- engineered mutation (24)
- engineered mutation (82)
- Chain 'C':
Compound: monobody
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6b2bc_ - Chain 'D':
Compound: monobody
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6b2bd_ - Heterogens: DMU, F, NA, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6b2bC (C:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>6b2bD (D:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt