PDB entry 6b1l

View 6b1l on RCSB PDB site
Description: Crystal structure of glycylpeptide N-tetradecanoyltransferase from Plasmodium vivax in complex with inhibitor IMP-0001173
Class: transferase
Keywords: SSGCID, glycylpeptide N-tetradecanoyltransferase, N-myristoyltransferase, NMT, Plasmodium vivax, Salvador I, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2017-09-18, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_085815
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b1la1, d6b1la2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_085815
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b1lb1
  • Heterogens: CJ4, MYA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b1lA (A:)
    mgsshhhhhhsaalevlfqgpdykfwytqpvpkindefnesvnepfisdnkvedvrkdey
    klppgyswyvcdvkdekdrseiytlltdnyvedddnifrfnysaefllwaltspnylktw
    higvkydasnkligfisaiptdicihkrtikmaevnflcvhktlrskrlapvlikeitrr
    inleniwqaiytagvylpkpvsdaryyhrsinvkklieigfsslnsrltmsraiklyrve
    dtlniknmrlmkkkdvegvhkllgsyleqfnlyavftkeeiahwflpienviytyvneen
    gkikdmisfyslpsqilgndkystlnaaysfynvtttatfkqlmqdaillakrnnfdvfn
    alevmqnksvfedlkfgegdgslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b1lA (A:)
    dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
    iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
    dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
    sdaryyhrsinvkklieigfstmsraiklyrvedtlniknmrlmkkkdvegvhkllgsyl
    eqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystlna
    aysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslkyyl
    ynwkcasfapahvgivll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b1lB (B:)
    mgsshhhhhhsaalevlfqgpdykfwytqpvpkindefnesvnepfisdnkvedvrkdey
    klppgyswyvcdvkdekdrseiytlltdnyvedddnifrfnysaefllwaltspnylktw
    higvkydasnkligfisaiptdicihkrtikmaevnflcvhktlrskrlapvlikeitrr
    inleniwqaiytagvylpkpvsdaryyhrsinvkklieigfsslnsrltmsraiklyrve
    dtlniknmrlmkkkdvegvhkllgsyleqfnlyavftkeeiahwflpienviytyvneen
    gkikdmisfyslpsqilgndkystlnaaysfynvtttatfkqlmqdaillakrnnfdvfn
    alevmqnksvfedlkfgegdgslkyylynwkcasfapahvgivll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b1lB (B:)
    dykfwytqpvpkindefnesvnepfisdnkvedvrkdeycdvkdekdrseiytlltdnyr
    fnysaefllwaltspnylktwhiisaiptdicihkrtikmaevnfllapvlikeitrrin
    leniwqaiytagvylpkpvsdaryyhrkklieyrvedtlnnmrlmkkkdvegvhkllgsy
    leqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqildkystlnaa
    ysfynvtttatfkqlmqdaillakrnnffnalevmqnksvfedlkfgegdgslkyylynw
    kcasfapahvgivll