PDB entry 6b11

View 6b11 on RCSB PDB site
Description: TylHI in complex with native substrate 23-deoxy-5-O-mycaminosyl-tylonolide (23-DMTL)
Class: oxidoreductase
Keywords: P450, tylosin biosynthesis, OXIDOREDUCTASE
Deposited on 2017-09-15, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: tylH1, tylHI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b11a_
  • Chain 'B':
    Compound: 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: tylH1, tylHI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6b11b_
  • Heterogens: HEM, CGM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6b11A (A:)
    mgsshhhhhhssglvprgshmsssgdarpsqkgillpaarandtdeaagrrsiawpvart
    cpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihpaklprlsps
    dgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtgllddltargdead
    lladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallelrdyldrlis
    gktgresgdgmlgsmvaqarggglshadvldnavlllaaghettasmvtmsvlvllqhpt
    awreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglvfllaaanrd
    eavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlpalrpttdva
    glrlksdsavfgvyelpvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b11A (A:)
    siawpvartcpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihp
    aklprlspsdgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtglldd
    ltargdeadlladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallel
    rdyldrlisgktgdgmlgsmvaqarggglshadvldnavlllaaghettasmvtmsvlvl
    lqhptawreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglvflla
    aanrdeavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlpalrp
    ttdvaglrlksdsavfgvyelpvaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6b11B (B:)
    mgsshhhhhhssglvprgshmsssgdarpsqkgillpaarandtdeaagrrsiawpvart
    cpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihpaklprlsps
    dgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtgllddltargdead
    lladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallelrdyldrlis
    gktgresgdgmlgsmvaqarggglshadvldnavlllaaghettasmvtmsvlvllqhpt
    awreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglvfllaaanrd
    eavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlpalrpttdva
    glrlksdsavfgvyelpvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b11B (B:)
    siawpvartcpfsppeqyaalraeepiaraelwdgapvwlisrqdhvralladprvsihp
    aklprlspsdgeaeasrslltldppdhgalrghfipefglrrvrelrpsveqivtglldd
    ltargdeadlladfalpmatqvicrlldipyedrdyfqerteqatrpaageealeallel
    rdyldrlisgkdgmlgsmvaqarggglshadvldnavlllaaghettasmvtmsvlvllq
    hptawreltvnpgllpgavdellrylsiadglrrsatadieidghtiragdglvfllaaa
    nrdeavfsepeafdihrsarrhvafgygphqclgqnlarmelevalgavlerlpalrptt
    dvaglrlksdsavfgvyelpvaw