PDB entry 6b0s

View 6b0s on RCSB PDB site
Description: Crystal structure of circumsporozoite protein aTSR domain in complex with 1710 antibody
Class: immune system
Keywords: Malaria, Circumsporozoite protein, alpha thrombospondin type-1 repeat, IMMUNE SYSTEM
Deposited on 2017-09-15, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Circumsporozoite protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: csp
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 1710 antibody, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6B0S (0-End)
  • Chain 'L':
    Compound: 1710 antibody, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6B0S
    Domains in SCOPe 2.07: d6b0sl1, d6b0sl2
  • Heterogens: GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6b0sL (L:)
    sayeltqppsvsvspgqtasitcsgdklgdkyacwyqqkpgqspvvviyqdtkrpsgipe
    rfsgsnsgntatltisgtqamdeadyycqawdsstvvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6b0sL (L:)
    yeltqppsvsvspgqtasitcsgdklgdkyacwyqqkpgqspvvviyqdtkrpsgiperf
    sgsnsgntatltisgtqamdeadyycqawdsstvvfgggtkltvlgqpkaapsvtlfpps
    seelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylslt
    peqwkshrsyscqvthegstvektvaptec