PDB entry 6azy

View 6azy on RCSB PDB site
Description: Crystal structure of Hsp104 R328M/R757M mutant from Calcarisporiella thermophila
Class: chaperone
Keywords: disaggregase, AAA+ ATPase, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, CHAPERONE
Deposited on 2017-09-13, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein Hsp104
    Species: Calcarisporiella thermophila [TaxId:911321]
    Gene: Calth2p4_003362
    Database cross-references and differences (RAF-indexed):
    • PDB 6AZY
    Domains in SCOPe 2.07: d6azya1, d6azya2, d6azya3
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6azyA (A:)
    snamssmqftdkatetlnaaakyaaenshvqlhpshvavvmldeenslfrsilekaggdv
    vsiergfkkimvrqpsqdppptemghspelakllhyahehmkkqrdlyiaqdhlilalad
    lpsmaqvlkeggvtkkslenavthvrgnrrvesksaeeayealskycidltelaasgkld
    pvigrdeiisrvirvlsrrtknnpclvgepgvgktaiaeglanrivkgdipsslqkkvys
    ldigsllagakyrgefeerlkavlkelkeaqaivfideihtvlgagksegaidaanllkp
    mlargelrcigattlteyrqyvekdpafermfqlvmveepsvtdtisilrglkeryethh
    gvriadaaivaaaqlaaryitqrfmpdkaidlideacantrvqldsqpeaidklerrhlq
    leveatalekekdaaskqrlqevraemariqeelrplkmkyesekgrldeirnlsqrlde
    lkakaedaerrydlaraadiryyaipdlekrlaqlqaeksqadaeradgllaevvgpdqi
    mevvsrwtgipvsnlqrsekekllhmeeymkqhvvgqdeaikaicdairlsrtglqnrnr
    plasflflgptgcgktlcvkelaaflfndpgaivridmseymekhavsrlvgappgyigh
    deggqlteavrrrpytvvlfdemekahkdvsnlllqilddghctdskgrrvdfkntiivm
    tsnlgadlfeldegdkvsqatknavlatarrhfanefinmidelivfnrltpsnirkivd
    vrlkevqerldekqitldvddkakdllaqqgfdpvygarplnrliqhalltqlsrllldg
    gvrpgeiakvtvdqegeiivirnhgiespapwadedmvededmei
    

    Sequence, based on observed residues (ATOM records): (download)
    >6azyA (A:)
    ssmqftdkatetlnaaakyaaenshvqlhpshvavvmldeenslfrsilekaggdvvsie
    rgfkkimvrqpsqdemghspelakllhyahehmkkqrdlyiaqdhlilaladlpsmaqvl
    keggvtkkslenavthvrgayealskycidltelaasgkldpvigrdeiisrvirvlsrr
    tknnpclvgepgvgktaiaeglanrivkgdipsslqkkvysldigsllagagefeerlka
    vlkelkeaqaivfideihtvlgaaidaanllkpmlargelrcigattlteyrqyvekdpa
    fermfqlvmveepsvtdtisilrglkeryethhgvriadaaivaaaqlaaryitqrfmpd
    kaidlideacantrvqldsqpeaidklerrhlqleveatalekekdaaskqrlqevraem
    ariqeelrplkmkyesekgrldeirnlsqrldelkakaedaerrydlaraadiryyaipd
    lekrlaqlqaeksqadaeradgllaevvgpdqimevvsrwtgipvsnlqrsekekllhme
    eymkqhvvgqdeaikaicdairlsrtglqnrnrplasflflgptgcgktlcvkelaaflf
    ndpgaivridmseymekhavsrlgqlteavrrrpytvvlfdemekahkdvsnlllqildd
    ghctdskgrrvdfkntiivmtsnltknavlatarrhfanefinmidelivfnrltpsnir
    kivdvrlkevqerldekqitldvddkakdllaqqgfdpvygarplnrliqhalltqlsrl
    lldggvrpgeiakvtvdqegeiivirnhgi