PDB entry 6ays

View 6ays on RCSB PDB site
Description: Crystal structure of Campylobacter jejuni 5'-methylthioadenosine/S-adenosyl homocysteine nucleosidase (MTAN) complexed with hexylthio-DADMe-Immucillin-A
Class: hydrolase, transferase
Keywords: MTAN enzyme, Foodborne Diseases, HYDROLASE, TRANSFERASE
Deposited on 2017-09-08, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysa1, d6aysa2
  • Chain 'B':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysb1, d6aysb2
  • Chain 'C':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysc1, d6aysc2
  • Chain 'D':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysd1, d6aysd2
  • Chain 'E':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6ayse1, d6ayse2
  • Chain 'F':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysf1, d6aysf2
  • Chain 'G':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysg1, d6aysg2
  • Chain 'H':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6aysh1, d6aysh2
  • Heterogens: EDO, HT6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aysA (A:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysA (A:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aysB (B:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysB (B:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aysC (C:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysC (C:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6aysD (D:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysD (D:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6aysE (E:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysE (E:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6aysF (F:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysF (F:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6aysG (G:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysG (G:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6aysH (H:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aysH (H:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl