PDB entry 6ayr

View 6ayr on RCSB PDB site
Description: Crystal structure of Campylobacter jejuni 5'-methylthioadenosine/S-adenosyl homocysteine nucleosidase (MTAN) complexed with butylthio-DADMe-Immucillin-A
Class: hydrolase, transferase
Keywords: MTAN enzyme, Foodborne Diseases, HYDROLASE, TRANSFERASE
Deposited on 2017-09-08, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6ayra1, d6ayra2
  • Chain 'B':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6ayrb1, d6ayrb2
  • Chain 'C':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6ayrc1, d6ayrc2
  • Chain 'D':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0M70_07260, AJY53_05400
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1E7P7U4 (10-237)
      • expression tag (9)
      • conflict (49)
    Domains in SCOPe 2.07: d6ayrd1, d6ayrd2
  • Heterogens: BIG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ayrA (A:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayrA (A:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ayrB (B:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayrB (B:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ayrC (C:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayrC (C:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ayrD (D:)
    mghhhhhhsgmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayski
    gkvnstlsasvmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplg
    fvpgneifiktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadac
    emegasvalvcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ayrD (D:)
    gmkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsa
    svmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifi
    ktdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasval
    vcdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl