PDB entry 6ayc

View 6ayc on RCSB PDB site
Description: Naegleria fowleri CYP51-itraconazole complex
Class: oxidoreductase
Keywords: CYP51, sterol 14alpha-demethylase, OXIDOREDUCTASE
Deposited on 2017-09-08, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obtusifoliol 14alpha-demethylase
    Species: Naegleria gruberi [TaxId:5762]
    Gene: NAEGRDRAFT_82952
    Database cross-references and differences (RAF-indexed):
    • PDB 6AYC
    Domains in SCOPe 2.07: d6ayca1, d6ayca2
  • Heterogens: HEM, 1YN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aycA (A:)
    makktsskgklpprvpnlipyvgsfvsfaknpvqfiidnskkygdvftatilgkemtfln
    hpkildtffkatdnelslrdvyrfmrpvfgtgvvydadstermmeqvkfvssglttarfr
    vfvdifedeiahkvkelgpegtvdvaelmadliiftasrcllgdevrqylseknlgklyh
    diddgisplsffypslpapkrdkarkavgeifqelldkrreehkkhperlldeskmdvvd
    hlltqkykdgqeltdvhrigiliaglfagqhtssitsswtlmnvisnkkvlekvrkeqee
    imgsdkvldydkvmkmdyleacmkealrmypplimimrmarkpreceqyiipkgnilvvs
    psvagrctdtytnpdvfdperlterkehekfkygavpfgagrhkcigenfallqvksiis
    illryfdmeyigkipdpsytslvvgpspptrmryklrkqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aycA (A:)
    klpprvpnlipyvgsfvsfaknpvqfiidnskkygdvftatilgkemtflnhpkildtff
    katdnelslrdvyrfmrpvfgtgvvydadstermmeqvkfvssglttarfrvfvdifede
    iahkvkelgpegtvdvaelmadliiftasrcllgdevrqylseknlgklyhdiddgispl
    sffypslpapkrdkarkavgeifqelldkrreehkkhperlldeskmdvvdhlltqkykd
    gqeltdvhrigiliaglfagqhtssitsswtlmnvisnkkvlekvrkeqeeimgsdkvld
    ydkvmkmdyleacmkealrmypplimimrmarkpreceqyiipkgnilvvspsvagrctd
    tytnpdvfdperlterkehekfkygavpfgagrhkcigenfallqvksiisillryfdme
    yigkipdpsytslvvgpspptrmryklrk