PDB entry 6axy

View 6axy on RCSB PDB site
Description: Structure of the V11I/T58A/I124A mutant of the HIV-1 capsid protein
Class: viral protein
Keywords: HIV-1 capsid protein, hexamer, V11I/T58A/I124A mutant, VIRAL PROTEIN
Deposited on 2017-09-07, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DRA0 (0-End)
      • engineered mutation (10)
      • engineered mutation (57)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d6axya1, d6axya2
  • Heterogens: IOD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6axyA (A:)
    pivqnlqgqmihqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnavg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppapvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axyA (A:)
    pivqmihqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnavgghqaa
    mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppap
    vgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwm
    tetllvqnanpdcktilkalgpgatleemmtacqgv