PDB entry 6axu

View 6axu on RCSB PDB site
Description: W203Y Epi-isozizaene synthase
Class: lyase
Keywords: Terpenoid Cyclase, LYASE
Deposited on 2017-09-07, released 2017-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K499
      • engineered mutation (223)
    Domains in SCOPe 2.06: d6axua_
  • Heterogens: BTM, POP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6axuA (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawffvwd
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiytdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6axuA (A:)
    avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
    yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
    dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
    ltfahwiytdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
    nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
    ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn