PDB entry 6awy

View 6awy on RCSB PDB site
Description: Structure of peanut allergen Ara h 8.01.
Class: protein binding
Keywords: plant protein, peanut, allergen, protein binding
Deposited on 2017-09-06, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6awya_
  • Chain 'B':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6awyb_
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awyA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awyB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy