PDB entry 6awt

View 6awt on RCSB PDB site
Description: Structure of PR 10 Allergen in complex with epicatechin
Class: plant protein
Keywords: plant protein, peanut, allergen
Deposited on 2017-09-06, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PR 10 protein
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AWT (0-155)
    Domains in SCOPe 2.07: d6awta_
  • Chain 'B':
    Compound: PR 10 protein
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AWT (0-155)
    Domains in SCOPe 2.07: d6awtb_
  • Chain 'C':
    Compound: PR 10 protein
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AWT (0-155)
    Domains in SCOPe 2.07: d6awtc_
  • Chain 'D':
    Compound: PR 10 protein
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AWT (0-155)
    Domains in SCOPe 2.07: d6awtd_
  • Heterogens: 28E, NA, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awtA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awtB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awtC (C:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awtD (D:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy