PDB entry 6awj

View 6awj on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with ADP and pantothenate analog Deoxy-MeO-N5Pan with pantothenate present in reaction
Class: transferase
Keywords: Staphylococcus aureus, SaPanK, ADP, pantothenate analog, TRANSFERASE
Deposited on 2017-09-05, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, AYM28_11860, AYM37_11860, ERS072738_01917, ERS074020_01878, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awja_
  • Chain 'B':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, AYM28_11860, AYM37_11860, ERS072738_01917, ERS074020_01878, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awjb_
  • Chain 'C':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, AYM28_11860, AYM37_11860, ERS072738_01917, ERS074020_01878, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awjc_
  • Chain 'D':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, AYM28_11860, AYM37_11860, ERS072738_01917, ERS074020_01878, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6awjd_
  • Heterogens: ADP, N7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awjA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6awjB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6awjB (B:)
    mkvgidaggtlikivqeqdrtfkteltknidqvvewlnqqqieklcltggnagviaenin
    ipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtggg
    miqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhh
    ldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytv
    lrgckpyyvengafsgaigalyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6awjC (C:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6awjD (D:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6awjD (D:)
    mkvgidaggtlikivqertfkteltknidqvvewlnqqqieklcltggnagviaeninip
    aqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgggmi
    qglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhhld
    adftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlr
    gckpyyvengafsgaigalyl