PDB entry 6aw5

View 6aw5 on RCSB PDB site
Description: 1.90A resolution structure of catechol O-methyltransferase (COMT) L136M (hexagonal form) from Nannospalax galili
Class: transferase
Keywords: Spalax, COMT, S-adenosylmethionine binding, TRANSFERASE
Deposited on 2017-09-05, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Nannospalax galili [TaxId:1026970]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AW5
    Domains in SCOPe 2.07: d6aw5a_
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aw5A (A:)
    mgdtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnps
    lvlelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasq
    dlipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdfla
    yvrgsssfecthyssyleymkvvdglekavykgpsspkqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aw5A (A:)
    dtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslv
    lelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdl
    ipqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekavykgps