PDB entry 6avp

View 6avp on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with ADP and pantothenate analog Phosphate-MeO-N5Pan
Class: transferase
Keywords: Staphylococcus aureus, SaPanK, ADP, pantothenate analog, TRANSFERASE
Deposited on 2017-09-04, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, ERS072840_01840, ERS073071_01656, ERS073583_01730, SAMEA2236422_02154, SAMEA2236459_02267, SAMEA2384700_01964, SAMEA2384800_02212, SAMEA2384856_02334, SAMEA2445640_02323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avpa_
  • Chain 'B':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, ERS072840_01840, ERS073071_01656, ERS073583_01730, SAMEA2236422_02154, SAMEA2236459_02267, SAMEA2384700_01964, SAMEA2384800_02212, SAMEA2384856_02334, SAMEA2445640_02323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avpb_
  • Chain 'C':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, ERS072840_01840, ERS073071_01656, ERS073583_01730, SAMEA2236422_02154, SAMEA2236459_02267, SAMEA2384700_01964, SAMEA2384800_02212, SAMEA2384856_02334, SAMEA2445640_02323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avpc_
  • Chain 'D':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, ERS072840_01840, ERS073071_01656, ERS073583_01730, SAMEA2236422_02154, SAMEA2236459_02267, SAMEA2384700_01964, SAMEA2384800_02212, SAMEA2384856_02334, SAMEA2445640_02323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6avpd_
  • Heterogens: ADP, N7E, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6avpA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6avpB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6avpC (C:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avpC (C:)
    vgidaggtlikivqertfkteltknidqvvewlnqqqieklcltggnagviaeninipaq
    ifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgggmiqg
    lgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhhldad
    ftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlrgc
    kpyyvengafsgaigalyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6avpD (D:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6avpD (D:)
    vgidaggtlikivqertfkteltknidqvvewlnqqqieklcltggnagviaeninipaq
    ifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgggmiqg
    lgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhhldad
    ftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlrgc
    kpyyvengafsgaigalyl