PDB entry 6aub

View 6aub on RCSB PDB site
Description: crystal structure of bruton's tyrosine kinase in complex with inhibitor cgi2815
Class: Transferase/Transferase Inhibitor
Keywords: BTK, Transferase-Transferase Inhibitor complex
Deposited on 2017-08-31, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (0-262)
      • expression tag (263)
    Domains in SCOPe 2.07: d6auba1, d6auba2
  • Heterogens: SO4, BXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aubA (A:)
    weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskf
    ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscw
    hekaderptfkillsnildvmden