PDB entry 6at3

View 6at3 on RCSB PDB site
Description: E. coli phosphoenolpyruvate carboxykinase Y207F mutant bound to thiosulfate and oxaloacetate
Class: lyase
Keywords: Nonnative ligand, LYASE
Deposited on 2017-08-27, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: pckA, pck, b3403, JW3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22259 (Start-539)
      • engineered mutation (206)
      • expression tag (540)
    Domains in SCOPe 2.07: d6at3a1, d6at3a2, d6at3a3
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: pckA, pck, b3403, JW3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22259 (Start-539)
      • engineered mutation (206)
    Domains in SCOPe 2.07: d6at3b1, d6at3b2
  • Heterogens: OAA, THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6at3A (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwfggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6at3A (A:)
    ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
    pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
    anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
    senfvafnltermqliggtwfggemkkgmfsmmnyllplkgiasmhcsanvgekgdvavf
    fglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairr
    dallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafg
    vlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevlv
    krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
    pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpklh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6at3B (B:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwfggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6at3B (B:)
    ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
    pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
    anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
    senfvafnltermqliggtwfggemkkgmfsmmnyllplkgiasmhcsanvgekgdvavf
    fglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairr
    dallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafg
    vlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevlv
    krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
    pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl