PDB entry 6asi

View 6asi on RCSB PDB site
Description: E. coli phosphoenolpyruvate carboxykinase G209S mutant bound to methanesulfonate
Class: lyase
Keywords: Nonnative ligand, LYASE
Deposited on 2017-08-24, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase (ATP)
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: pckA, pck, b3403, JW3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22259 (Start-539)
      • engineered mutation (208)
      • expression tag (540-542)
    Domains in SCOPe 2.07: d6asia1, d6asia2, d6asia3
  • Heterogens: 03S, ATP, MG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6asiA (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwygsemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6asiA (A:)
    tpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrsp
    kdkyivrddttrdtfwwadkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcganp
    dtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnsen
    fvafnltermqliggtwygsemkkgmfsmmnyllplkgiasmhcsanvgekgdvavffgl
    sgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairrdal
    lenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafgvlp
    pvsrltadqtqyhflsgftaklgiteptptfsacfgaaflslhptqyaevlvkrmqaaga
    qaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptelpgvdtkil
    dprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpklhhh