PDB entry 6arp

View 6arp on RCSB PDB site
Description: Structure of a mutant Cetuximab Fab fragment
Class: immune system
Keywords: Erbitux, antibody, EGFR, IMMUNE SYSTEM
Deposited on 2017-08-23, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cetuximab mutant light chain,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ARP (0-105)
    • Uniprot Q8TCD0 (106-End)
    Domains in SCOPe 2.07: d6arpa1, d6arpa2
  • Chain 'B':
    Compound: Cetuximab mutant Fab heavy chain,Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ARP (0-118)
    • Uniprot P0DOX5 (119-End)
  • Chain 'C':
    Compound: Cetuximab mutant light chain,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ARP (0-105)
    • Uniprot Q8TCD0 (106-End)
    Domains in SCOPe 2.07: d6arpc1, d6arpc2
  • Chain 'D':
    Compound: Cetuximab mutant Fab heavy chain,Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ARP (0-118)
    • Uniprot P0DOX5 (119-End)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6arpA (A:)
    dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyadesidgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6arpA (A:)
    dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyadesidgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6arpC (C:)
    dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyadesidgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6arpC (C:)
    dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyadesidgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.