PDB entry 6aq1

View 6aq1 on RCSB PDB site
Description: The crystal structure of human FABP3
Class: transport protein
Keywords: human, FABP3, TRANSPORT PROTEIN
Deposited on 2017-08-18, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (3-135)
      • expression tag (2)
    Domains in SCOPe 2.07: d6aq1a1, d6aq1a2
  • Chain 'B':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (3-135)
      • expression tag (2)
    Domains in SCOPe 2.07: d6aq1b1, d6aq1b2
  • Heterogens: SO4, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aq1A (A:)
    gshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthst
    fknteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgklilt
    lthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aq1A (A:)
    hmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfk
    nteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlt
    hgtavctrtyekea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aq1B (B:)
    gshmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthst
    fknteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgklilt
    lthgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aq1B (B:)
    hmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfk
    nteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlt
    hgtavctrtyekea