PDB entry 6ap4

View 6ap4 on RCSB PDB site
Description: Crystal structure of the DNA polymerase III subunit beta from Acinetobacter baumannii
Class: transferase
Keywords: DNA Binding, DNA Directed DNA Polymerase Activity, TRANSFERASE
Deposited on 2017-08-16, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4a1, d6ap4a2, d6ap4a3, d6ap4a4
  • Chain 'B':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d6ap4b1, d6ap4b2, d6ap4b3, d6ap4b4
  • Chain 'C':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6ap4c1, d6ap4c2, d6ap4c3, d6ap4c4
  • Chain 'D':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6ap4d1, d6ap4d2, d6ap4d3, d6ap4d4
  • Chain 'E':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d6ap4e1, d6ap4e2, d6ap4e3, d6ap4e4
  • Chain 'F':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4f1, d6ap4f2, d6ap4f3, d6ap4f4
  • Chain 'G':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4g1, d6ap4g2, d6ap4g3, d6ap4g4
  • Chain 'H':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6ap4h1, d6ap4h2, d6ap4h3, d6ap4h4
  • Chain 'I':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4i1, d6ap4i2, d6ap4i3, d6ap4i4
  • Chain 'J':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6ap4j1, d6ap4j2, d6ap4j3, d6ap4j4
  • Chain 'K':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ap4k1, d6ap4k2, d6ap4k3
  • Chain 'L':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d6ap4l1, d6ap4l2, d6ap4l3, d6ap4l4
  • Chain 'M':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d6ap4m1, d6ap4m2, d6ap4m3, d6ap4m4
  • Chain 'N':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d6ap4n1, d6ap4n2, d6ap4n3, d6ap4n4
  • Chain 'O':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4o1, d6ap4o2, d6ap4o3, d6ap4o4
  • Chain 'P':
    Compound: DNA polymerase III subunit beta
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: dnaN, A7M79_16225, A7M90_19325, A7N09_15145, AB895_1514, ABUW_0002, APD06_07570, APD31_16715, AZE33_00010, B4R90_12040, B9X95_11540, BGC29_18735, BWP00_10155, CAS83_08665, CBI29_00019, CEB38_18810, IX87_14440, LV38_03508
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5V7W3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d6ap4p1, d6ap4p2, d6ap4p3, d6ap4p4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ap4A (A:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4A (A:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    segacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedy
    pllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdgh
    rlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpeqgd
    itvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnq
    dslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsv
    lvqdpahpdqtyvvmpmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ap4B (B:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4B (B:)
    hhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvasta
    lsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaed
    ypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdg
    hrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsrd
    keqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvf
    lnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmte
    anqsvlvqdpahpdqtyvvmpm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ap4C (C:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4C (C:)
    hhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvast
    alsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpae
    dypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttd
    ghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtindkeq
    gditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnf
    nqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanq
    svlvqdpahpdqtyvvmpm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ap4D (D:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4D (D:)
    hhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvast
    alsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpae
    dypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttd
    ghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsk
    eqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvfl
    nfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmtea
    nqsvlvqdpahpdqtyvvmpmr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ap4E (E:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4E (E:)
    hhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvasta
    lsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaed
    ypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdg
    hrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsrd
    keqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvf
    lnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmte
    anqsvlvqdpahpdqtyvvmpm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ap4F (F:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4F (F:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    segacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedy
    pllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdgh
    rlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsrdq
    gditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnf
    nqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanq
    svlvqdpahpdqtyvvmpm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ap4G (G:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4G (G:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    segacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedy
    pllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdgh
    rlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintkeqgd
    itvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnq
    dslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsv
    lvqdpahpdqtyvvmpmr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ap4H (H:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4H (H:)
    hhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvast
    alsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpae
    dypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttd
    ghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsr
    dkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgv
    flnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmt
    eanqsvlvqdpahpdqtyvvmpm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ap4I (I:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4I (I:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    segacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedy
    plltgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdghrlalc
    eilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpditvrfttk
    lidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlran
    npeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahp
    dqtyvvmpmr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ap4J (J:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4J (J:)
    hhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvast
    alsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpae
    dypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttd
    ghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsr
    dkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgv
    flnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmt
    eanqsvlvqdpahpdqtyvvmpmr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ap4K (K:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4K (K:)
    mrlkiakesllnvlshvvgaverrhtlnilsnvkiqtltitgsdlevelvastalsegac
    leatvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedypllttens
    qgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdghrlalceil
    asstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintitvrfttklidgk
    fpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqd
    eaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahpdqtyv
    vmpmr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ap4L (L:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4L (L:)
    hhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvasta
    lsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaed
    ypllqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdghrlal
    ceilasslvqaivprkavgelqrllsiedeqltlligrellnvtintpsrdkeqgditvr
    fttklidgkfpdyrrvipdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqdea
    iedlaqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpqtyvvmpmr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ap4M (M:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4M (M:)
    hhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvasta
    lsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaed
    ypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdg
    hrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtinteqgd
    itvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnq
    dslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsv
    lvqdpahpdqtyvvmpmr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ap4N (N:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4N (N:)
    hhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvasta
    lsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaed
    ypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidelravttdghr
    lalceilassvqaivprkavgelqrllsiedeqltlligrellnvtintpeqgditvrft
    tklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlr
    annpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpa
    hpdqtyvvmpmr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ap4O (O:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4O (O:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    sleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedypllq
    gtqvqvtqrelkrlfektafamavqdvrfyltgtllelravttdghrlalceilasstss
    vqaivprkavgelqrllsiedeqltlligrellnvtintitvrfttklidgkfpdyrrvi
    prggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqdeaiedlai
    qyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahpdqtyvvmpmr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6ap4P (P:)
    hhhhhhmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelv
    astalsegacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtl
    paedypllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlrav
    ttdghrlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtint
    psrdkeqgditvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsnekl
    rgvflnfnqdslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnm
    smteanqsvlvqdpahpdqtyvvmpmrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap4P (P:)
    hmrlkiakesllnvlshvvgaverrhtlnilsnvkiqtnaqaltitgsdlevelvastal
    segacleagettvparklmeickslptaalidlqitedqrcilksgnsrfvlgtlpaedy
    pllttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdgh
    rlalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsqgd
    itvrfttklidgkfpdyrrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnq
    dslqlrannpeqdeaiedlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsv
    lvqdpahpdqtyvvmpm