PDB entry 6anx

View 6anx on RCSB PDB site
Description: Peroxide Activation Regulated by Hydrogen Bonds within Artificial Cu Proteins - WT (low exposure)
Class: metal binding protein
Keywords: streptavidin, biotin, copper, hydroperoxo, secondary coordination sphere, hydrogen bond, biotin binding protein, METAL BINDING PROTEIN
Deposited on 2017-08-14, released 2017-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (9-12)
    Domains in SCOPe 2.08: d6anxa1, d6anxa2
  • Heterogens: SI0, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6anxA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6anxA (A:)
    mgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgs
    gtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdt
    ftkvk