PDB entry 6amx

View 6amx on RCSB PDB site
Description: Crystal Structure of Nucelotide Binding Domain of O-antigen polysaccharide ABC-transporter
Class: transport protein
Keywords: Nucleotide Binding Domain from abcT4, TRANSPORT PROTEIN
Deposited on 2017-08-11, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: abcT4, aq_1094
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67181 (0-233)
      • expression tag (234-238)
    Domains in SCOPe 2.07: d6amxa1, d6amxa2
  • Heterogens: PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6amxA (A:)
    irvfdvwkkykyykkpqdrlkeiifrkpfheelwvlkginleiekgevlgivgpngagks
    tllkvitgvtepdkgfversgkvvgllelgtgfnyelsgleniyvnasllglsrreidek
    lesiiefselddfinkplktyssgmimrlafsiaihtepecfiidealavgdahfqqkcf
    rklkehkqkggsiifvshdmnavkilcdraillhkgeiieegspetvtqayyklklhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6amxA (A:)
    irvfdvwkkykyykkpqdrlkeiifrkpfheelwvlkginleiekgevlgivgpngagks
    tllkvitgvtepdkgfversgkvvgllelgtgfnyelsgleniyvnasllglsrreidek
    lesiiefselddfinkplktyssgmimrlafsiaihtepecfiidealavgdahfqqkcf
    rklkehkqkggsiifvshdmnavkilcdraillhkgeiieegspetvtqayyklklhhh