PDB entry 6amh

View 6amh on RCSB PDB site
Description: Engineered tryptophan synthase b-subunit from Pyrococcus furiosus, PfTrpB4D11 with Ser bound as E(Aex1)
Class: biosynthetic protein
Keywords: PLP Type II, Tryptophan Synthase, Engineered, Allostery, BIOSYNTHETIC PROTEIN
Deposited on 2017-08-09, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-387)
      • engineered mutation (16)
      • engineered mutation (67)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (320)
    Domains in SCOPe 2.07: d6amha_
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-387)
      • engineered mutation (16)
      • engineered mutation (67)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (320)
      • expression tag (388-393)
    Domains in SCOPe 2.07: d6amhb1, d6amhb2
  • Chain 'C':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (16)
      • engineered mutation (67)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (320)
    Domains in SCOPe 2.07: d6amhc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-End)
      • engineered mutation (16)
      • engineered mutation (67)
      • engineered mutation (273)
      • engineered mutation (291)
      • engineered mutation (320)
    Domains in SCOPe 2.07: d6amhd_
  • Heterogens: PLS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6amhA (A:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6amhA (A:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6amhB (B:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6amhB (B:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqgqikpshsiapgldypg
    vgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakemsrd
    eiiivnlsgrgdkdldivlkvsgnvlehhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6amhC (C:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6amhC (C:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6amhD (D:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6amhD (D:)
    mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
    ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs