PDB entry 6ale

View 6ale on RCSB PDB site
Description: A V-to-F substitution in SK2 channels causes Ca2+ hypersensitivity and improves locomotion in a C. elegans ALS model
Class: metal transport
Keywords: Calcium binding protein, METAL TRANSPORT
Deposited on 2017-08-07, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Small conductance calcium-activated potassium channel protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2S1 (0-92)
      • conflict (0)
      • conflict (12)
      • expression tag (93-94)
  • Chain 'R':
    Compound: Calmodulin-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Calm2, Cam2, Camb, CaMII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DP30 (2-145)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6aler1, d6aler2
  • Heterogens: SO4, 1KP, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6aleR (R:)
aalteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
demireadidgdgqvnyeefvqmmta