PDB entry 6alc

View 6alc on RCSB PDB site
Description: CREBBP bromodomain in complex with Cpd 4 (1-(1-(cyclopropylmethyl)-3-(1H-indol-4-yl)-1,4,6,7-tetrahydro-5H-pyrazolo[4,3-c]pyridin-5-yl)ethan-1-one)
Class: protein binding/inhibitor
Keywords: CREBBP, Bromodomain, small molecule inhibitor, PROTEIN BINDING-INHIBITOR complex
Deposited on 2017-08-07, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-113)
      • expression tag (0-1)
      • conflict (112)
    Domains in SCOPe 2.08: d6alca1, d6alca2
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-113)
      • expression tag (0-1)
      • conflict (112)
    Domains in SCOPe 2.08: d6alcb1, d6alcb2
  • Heterogens: DMS, EDO, BKD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6alcA (A:)
    aafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6alcB (B:)
    aafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal