PDB entry 6al3

View 6al3 on RCSB PDB site
Description: Lys49 PLA2 BPII derived from the venom of Protobothrops flavoviridis.
Class: toxin
Keywords: Phospholipase A2, toxic components, nake venom, TOXIN
Deposited on 2018-09-05, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 BP-II
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6al3a_
  • Chain 'B':
    Compound: Basic phospholipase A2 BP-II
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6al3b_
  • Chain 'C':
    Compound: Basic phospholipase A2 BP-II
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6al3c_
  • Chain 'D':
    Compound: Basic phospholipase A2 BP-II
    Species: Protobothrops flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6al3d_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6al3A (A:)
    slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
    mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
    tc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6al3B (B:)
    slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
    mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
    tc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6al3C (C:)
    slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
    mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
    tc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6al3D (D:)
    slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
    mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
    tc