PDB entry 6aku

View 6aku on RCSB PDB site
Description: Cryo-EM structure of CVA10 empty particle
Class: virus
Keywords: picornavirus uncoating, receptor binding, VIRUS
Deposited on 2018-09-03, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: EM
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vp2
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6akub_
  • Chain 'C':
    Compound: vp3
    Species: Coxsackievirus A10 [TaxId:42769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6akuc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6akuB (B:)
    spsveacgysdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsv
    nrfytldskmwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqg
    allvavipefviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyp
    hqwinlrtnncatvivpyinavpfdsainhsnfglivipvsplkyssgattaipititia
    plnsefgglrqavsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6akuB (B:)
    aanivlaygewpeycpdkptrpdvsvnrfytldskmwqenstgwywkfpdvlnktgvfgq
    naqfhylyrsgfclhvqcnaskfhqgallvavipefviagrggftttfpgttgatfhdpy
    vldsgvplsqaliyphqwinlrtnncatvivpyinavpfdsainhsnfglivipvsplky
    ssgattaipititiaplnsef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6akuC (C:)
    gipaelrpgtnqflttdddtaapilpgftptptihipgevhsllelcrvetilevnntte
    atgltrllipvssqnkadelcaafmvdpgrigpwqstlvgqicryytqwsgslkvtfmft
    gsfmatgkmlvaysppgsaqpanretamlgthviwdfglqssvslvipwisnthfrtakt
    ggnydyytagvvtlwyqtnyvvppetpgeayiiamgadlykftlkickdtdevtqqavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6akuC (C:)
    gipaelrpgtnqflttdddtaapilpgftptptihipgevhsllelcrvetilevnntte
    atgltrllipvssqnkadelcaafmvdpgrigpwqstlvgqicryytqwsgslkvtfmft
    gsfmatgkmlvaysppgsaqpanretamlgthviwdfglqssvslvipwisnthfrtakt
    ytagvvtlwyqtnyvvppetpgeayiiamgadlykftlkickdtdevtq