PDB entry 6aij

View 6aij on RCSB PDB site
Description: Cyclodextrin glycosyltransferase from Paenibacillus macerans mutant N603D
Class: sugar binding protein
Keywords: Cyclodextrin glycosyltransferase, Paenibacillus macerans, SUGAR BINDING PROTEIN
Deposited on 2018-08-24, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Paenibacillus macerans [TaxId:44252]
    Gene: cgtM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04830 (Start-707)
      • see sequence details (176-177)
      • engineered mutation (624)
    Domains in SCOPe 2.07: d6aija1, d6aija2, d6aija3, d6aija4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aijA (A:)
    mkktaiaiavalagfatvaqaspdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdaf
    sgdrsnlklyfggdwqgiidkindgyltgmgvtalwisqpvenitsvikysgvnntsyhg
    ywardfkqtndafgdfadfqnlidtahahnikvvidfapnhtspadrdnpgfaengalyd
    ngsllgaysndtaglfhhnggtdfstiedgiyknlydladinhnnnamdayfksaidlwl
    gmgvdgirfdavkhmpfgwqksfvssiyggdhpvftfgewylgadqtdgdnikfanesgm
    nlldfeyaqevrevfrdktetmkdlyevlastesqydyinnmvtfidnhdmdrfqvagsg
    trateqalaltltsrgvpaiyygteqymtgdgdpnnrammtsfntgttaykviqalaplr
    ksnpaiaygttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysd
    vlngllngnsitvgsggavtnftlaaggtavwqytapetspaignvgptmgqpgnivtid
    grgfggtagtvyfgttavtgsgivswedtqikavipkvaagktgvsvktssgtasntfks
    fnvltgdqvtvrflvnqantnygtdvylvgnaaelgswdpnkaigpmynqviakypswyy
    dvsvpagtkldfkfikkgggtvtwegggnhtyttpasgvgtvtvdwqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aijA (A:)
    spdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdafsgdrsnlklyfggdwqgiidk
    indgyltgmgvtalwisqpvenitsvikysgvnntsyhgywardfkqtndafgdfadfqn
    lidtahahnikvvidfapnhtspadrdnpgfaengalydngsllgaysndtaglfhhngg
    tdfstiedgiyknlydladinhnnnamdayfksaidlwlgmgvdgirfdavkhmpfgwqk
    sfvssiyggdhpvftfgewylgadqtdgdnikfanesgmnlldfeyaqevrevfrdktet
    mkdlyevlastesqydyinnmvtfidnhdmdrfqvagsgtrateqalaltltsrgvpaiy
    ygteqymtgdgdpnnrammtsfntgttaykviqalaplrksnpaiaygttterwvnndvl
    iierkfgssaalvainrnssaaypisgllsslpagtysdvlngllngnsitvgsggavtn
    ftlaaggtavwqytapetspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgs
    givswedtqikavipkvaagktgvsvktssgtasntfksfnvltgdqvtvrflvnqantn
    ygtdvylvgnaaelgswdpnkaigpmynqviakypswyydvsvpagtkldfkfikkgggt
    vtwegggnhtyttpasgvgtvtvdwqn