PDB entry 6aib

View 6aib on RCSB PDB site
Description: Crystal structures of the N-terminal RecA-like domain 1 of Staphylococcus aureus DEAD-box Cold shock RNA helicase CshA
Class: structural protein
Keywords: structural protein
Deposited on 2018-08-22, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DEAD-box ATP-dependent RNA helicase CshA
    Species: Staphylococcus aureus subsp. aureus MRSA252 [TaxId:282458]
    Gene: cshA, SAR2168
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aiba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aibA (A:)
    mqnfkelgisdntvqslesmgfkeptpiqkdsipyalqgidilgqaqtgtgktgafgipl
    iekvvgkqgvqslilaptrelamqvaeqlrefsrgqgvqvvtvfggmpierqikalkkgp
    qivvgtpgrvidhlnrrtlktdgihtlildeademmnmgfiddmrfimdkipavqrqtml
    fsatmpkaiqalvqqfmkspkiiktmnnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aibA (A:)
    fkelgisdntvqslesmgfkeptpiqkdsipyalqgidilgqaqtgtgktgafgipliek
    vvgkqgvqslilaptrelamqvaeqlrefsrgqgvqvvtvfggmpierqikalkkgpqiv
    vgtpgrvidhlnrrtlktdgihtlildeademmnmgfiddmrfimdkipavqrqtmlfsa
    tmpkaiqalvqqfmkspkiik